PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400030318
Common NameLOC102602059
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 320aa    MW: 36290.8 Da    PI: 6.7408
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400030318genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.41.4e-33181238259
                           --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                           +Dgy+WrKYGqK vk+s+fprsYYrCts++C+vkk+vers edp++v++tYeg+Hnh+
  PGSC0003DMP400030318 181 EDGYRWRKYGQKAVKNSPFPRSYYRCTSQKCSVKKRVERSYEDPSIVITTYEGQHNHH 238
                           8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.4E-35165240IPR003657WRKY domain
SuperFamilySSF1182902.09E-29172240IPR003657WRKY domain
PROSITE profilePS5081131.961175240IPR003657WRKY domain
SMARTSM007743.5E-39180239IPR003657WRKY domain
PfamPF031061.1E-26181238IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MSDNNPFNHD YAFPFFGENP SIYANQANST QNPHHNHQDF DYPSSYMSNL TECLHGGSMD  60
HYNTLSSAFG MNNCSSSSEV VCPQPSIDHQ ECSRKNIKSV DNQIPLTPNS LISSSSNSEA  120
GGCHEEDSSK IKKDDDQCEL DGDDDDNKSK KVGKLAKKKG EKKQKEPRFA FMTKSEIDNL  180
EDGYRWRKYG QKAVKNSPFP RSYYRCTSQK CSVKKRVERS YEDPSIVITT YEGQHNHHCP  240
ATLRGNAAAA LLSPSFLSST QQQLYHNPNE QQIFYNPNIP INNSFYNNYH QQQPQLGPDH  300
YQYGLFQDMV SSLINKREP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-261732411078Probable WRKY transcription factor 4
1wj2_A1e-261732411078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC1700360.0KC170036.1 Solanum lycopersicum WRKY16 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006348957.10.0PREDICTED: probable WRKY transcription factor 71
SwissprotQ8VWJ23e-53WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLM1BGK70.0M1BGK7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000447210.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14852475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.11e-45WRKY DNA-binding protein 71
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]